Buy IGF-1 DES 1mg
Introduction
IGF-1 DES is a unique form of insulin-like growth factor-1 found in the brain, breast milk, and uterine tissue. It plays a crucial role in stimulating hypertrophy and hyperplasia across different cell lines. Its enhanced bioavailability makes it a more potent version of IGF-1, with promising applications in medical research.
Product Details
- Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKAAKSA
- Molecular Formula: C319H495N91O96S7
- Molecular Weight: 7365.4225 g/mol
- CAS Number: 112603-35-7
- Synonyms: Des(1-3) IGF-1, Insulin-like growth factor 1, des-(1-3)-
Benefits and Applications
- Enhanced Potency: IGF-1 DES is approximately 10 times more potent than IGF-1 due to its reduced binding to IGF-1 binding proteins, increasing its bioavailability.
- Neurological Research: Studies suggest IGF-1 DES supports synaptic health, making it a potential therapeutic agent for autism and other neurodevelopmental disorders.
- Muscle and Tissue Repair: It promotes muscle growth and repair, even in conditions of limited caloric intake, making it a candidate for addressing chronic illnesses and catabolic conditions.
- Potential in Treating Hyperglycemia: IGF-1 DES shows promise in lowering blood sugar levels more effectively than standard IGF-1, offering a potential alternative to insulin with fewer long-term side effects.
Quality Assurance
IGF-1 DES is synthesized under stringent quality control measures, ensuring a purity level of over 99%. Each batch is verified for consistency and quality, meeting the highest standards for research applications.
Usage Instructions
IGF-1 DES is intended for research purposes only. Appropriate safety and handling procedures must be followed. It is not for human consumption.
Shipping and Handling
Orders are shipped globally from the USA and Europe. Orders over $200 qualify for free shipping. Orders placed before noon PST are shipped the same business day, ensuring timely delivery.
Customer Support
For any questions or issues, our dedicated customer support team is available 24/7. Contact us via email at se*****@pe***************.com for assistance.
Legal Disclaimer
IGF-1 DES is sold strictly for educational and scientific research purposes only. It is not intended for human use. Ensure compliance with local regulations before purchasing.
Call to Action
Discover the potential of IGF-1 DES in advancing your research. Order now and benefit from our secure online ordering and reliable global shipping services.
Caleb Bailey (verified owner) –
Provides exceptional stability for precision-driven peptide studies.
Beckett Foster (verified owner) –
So glad I found this! It’s exactly what I needed.
Madelyn Gonzales (verified owner) –
Exactly as described. Couldn’t be happier!
Emily Hughes (verified owner) –
Exactly what I needed and at a great price.
Lucas Bailey (verified owner) –
Engineered to meet the rigorous standards of peptide research.