Cagrilintide 10mg

Buy Cagrilintide 10mg

Introduction
Cagrilintide is a synthetic version of amylin, designed to overcome the limitations of its natural counterpart. Its enhanced stability and prolonged activity offer promising applications in weight management and metabolic disorders, positioning it as a potential adjunct in obesity and diabetes treatments.

Product Details

• Product Name: Cagrilintide
• CAS Number: 1415456-99-3
• Synonyms: AT42613, AM833
• Molecular Formula: C194H312N54O59S2.xC2H4O2
• Molecular Weight: 4409.01 g/mol
• Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
• PubChem SID: 171397054
• Form: Lyophilized powder
• Concentration: 10mg per vial

Benefits and Applications
1. Obesity Management
Cagrilintide has demonstrated significant weight loss effects, with trials showing a reduction of 6-11% in body mass within six weeks. Combined with semaglutide, the weight loss effect can be as high as 17%, indicating a synergistic relationship that could redefine obesity treatment strategies.

2. Type 2 Diabetes Treatment
Cagrilintide reduces postprandial glucose spikes by slowing gastric emptying and promoting satiety, leading to improved glucose control and reduced insulin resistance. Its weekly dosing enhances compliance and sustained glycemic control.

3. Liver and Cardiovascular Health
Studies indicate potential benefits in managing liver damage and alcohol-related liver disease, alongside cardiovascular improvements. These findings suggest Cagrilintide’s role extends beyond metabolic regulation.

4. Alzheimer’s Disease Research
While no direct studies exist, speculation about Cagrilintide’s impact on amyloid-beta plaques in Alzheimer’s disease is encouraging. Its role in mitigating cognitive decline is an exciting frontier for further research.

Quality Assurance
Peptide Science Hub ensures that Cagrilintide 10mg is synthesized to a purity of over 99%, following stringent quality control protocols. Each batch is verified for consistency and reliability, guaranteeing the highest research standards.

Usage Instructions

• Reconstitution: Reconstitute using a suitable solvent following the specific research protocol.
• Storage: Store the lyophilized powder at -20°C and use immediately after reconstitution, or as advised in the protocol.
• Intended Use: For research purposes only, not for human or veterinary use.

Shipping and Handling
Peptide Science Hub offers reliable global shipping with free delivery on orders over $200. Orders placed before noon PST ship the same business day. Tracking information is provided with each shipment to ensure timely delivery.

Customer Support
For support, contact our team at service@peptidesciencehub.com. We are available 24/7 to assist with inquiries and provide guidance on product use. Please note that cancellations are accepted before shipment, but returns are not permitted due to the nature of the products.

Legal Disclaimer
Cagrilintide 10mg is intended for research use only. It is not approved for human or veterinary applications. All information provided is for educational purposes, and users should adhere to all applicable safety guidelines.

Call to Action
Unlock the potential of Cagrilintide 10mg in your research. Order today from Peptide Science Hub to benefit from high-quality products, comprehensive support, and worldwide shipping services.